Novus Biologicals products are now on bio-techne.com

SPINK1 Antibody

Images

 
Immunohistochemistry: SPINK1 Antibody [NBP1-87314] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPINK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPINK1 Protein (NBP1-87314PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK1 Antibody

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • SPINK1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor

Background

SPINK1 (Serine protease inhibitor, Kazal type I) is a trypsin inhibitor which is secreted from pancreatic acinar cells into pancreatic juice. It prevents the trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3848
Species: Hu
Applications: IHC, IP, WB
H00136541-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
AF1927
Species: Hu
Applications: IP, WB
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DY1707
Species: Hu
Applications: ELISA
NBP1-87314
Species: Hu
Applications: IHC

Publications for SPINK1 Antibody (NBP1-87314) (0)

There are no publications for SPINK1 Antibody (NBP1-87314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK1 Antibody (NBP1-87314) (0)

There are no reviews for SPINK1 Antibody (NBP1-87314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPINK1 Antibody (NBP1-87314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK1 Products

Research Areas for SPINK1 Antibody (NBP1-87314)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK1