SPG3A Antibody

Images

 
Immunohistochemistry: SPG3A Antibody [NBP1-90234] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPG3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPG3A Protein (NBP1-90234PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPG3A Antibody

  • AD-FSP
  • atlastin GTPase 1
  • atlastin1
  • atlastin-1
  • Brain-specific GTP-binding protein
  • EC 3.6.5.-
  • FSP1
  • GBP3
  • GBP-3
  • GTP-binding protein 3
  • Guanine nucleotide-binding protein 3
  • guanylate-binding protein 3
  • Spastic paraplegia 3 protein A
  • spastic paraplegia 3A (autosomal dominant)
  • SPG3
  • SPG3AhGBP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90234
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SPG3A Antibody (NBP1-90234) (0)

There are no publications for SPG3A Antibody (NBP1-90234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPG3A Antibody (NBP1-90234) (0)

There are no reviews for SPG3A Antibody (NBP1-90234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPG3A Antibody (NBP1-90234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPG3A Products

Bioinformatics Tool for SPG3A Antibody (NBP1-90234)

Discover related pathways, diseases and genes to SPG3A Antibody (NBP1-90234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPG3A Antibody (NBP1-90234)

Discover more about diseases related to SPG3A Antibody (NBP1-90234).
 

Pathways for SPG3A Antibody (NBP1-90234)

View related products by pathway.

PTMs for SPG3A Antibody (NBP1-90234)

Learn more about PTMs related to SPG3A Antibody (NBP1-90234).

Blogs on SPG3A

There are no specific blogs for SPG3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPG3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATL1