Kinesin 5A Antibody - BSA Free

Western Blot: Kinesin 5A Antibody [NBP1-85344] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse hippocampus shows positivity in a subset of neurons.

Western Blot: Kinesin 5A Antibody [NBP1-85344] - Analysis in human cerebral cortex tissue.

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human hippocampus shows positivity in subsets of neuronal cells.

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells, as well as positivity in the molecular and granular cell layers.

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse red nucleus shows immunoreactivity in neuronal cell bodies.

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse olfactory bulb shows positivity in mitral cell layer neurons and processes in plexiform layer.

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse lateral septum shows immunoreactivity in a subset of neurons.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kinesin 5A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF5A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kinesin 5A Protein (NBP1-85344PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kinesin 5A Antibody - BSA Free

• D12S1889
• KIF5A variant protein
• kinesin family member 5A
• kinesin heavy chain isoform 5A
• Kinesin heavy chain neuron-specific 1
• kinesin, heavy chain, neuron-specific
• MY050
• Neuronal kinesin heavy chain
• NKHC1
• NKHCspastic paraplegia 10 (autosomal dominant)
• SPG10

Background

Kinesin 5A is part of a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types and is subject to spatial and temporal regulation. These proteins have a modular structure including a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. There are currently three known Kinesin 5 family members denoted as A, B, and C. Kinesin 5A and kinesin 5C appear to be exclusively neuronal, whereas kinesin 5B appears to be ubiquitous in its expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF5A