Spectrin beta 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human skin shows high expression.
Immunohistochemistry: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48794] - Staining in human skin and endometrium tissues using anti-SPTBN2 antibody. Corresponding SPTBN2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Spectrin beta 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
Specificity
Specificity of human Spectrin beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTBN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Spectrin beta 3 Recombinant Protein Antigen (NBP2-48794PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Spectrin beta 3 Antibody

  • beta-III Spectrin
  • glutamate transporter EAAT4-associated protein 41
  • GTRAP41
  • KIAA0302
  • SCA5
  • SCAR14
  • Spectrin beta 3
  • spectrin beta chain, brain 2
  • Spectrin beta III
  • spectrin, beta, non-erythrocytic 2
  • Spectrin, non-erythroid beta chain 2
  • spinocerebellar ataxia 5
  • SPTBN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52176
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-55745
Species: Hu
Applications: ICC/IF
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP1-84938
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49081
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Spectrin beta 3 Antibody (NBP2-48794) (0)

There are no publications for Spectrin beta 3 Antibody (NBP2-48794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 3 Antibody (NBP2-48794) (0)

There are no reviews for Spectrin beta 3 Antibody (NBP2-48794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Spectrin beta 3 Antibody (NBP2-48794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Spectrin beta 3 Antibody (NBP2-48794)

Discover related pathways, diseases and genes to Spectrin beta 3 Antibody (NBP2-48794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Spectrin beta 3 Antibody (NBP2-48794)

Discover more about diseases related to Spectrin beta 3 Antibody (NBP2-48794).
 

Pathways for Spectrin beta 3 Antibody (NBP2-48794)

View related products by pathway.

PTMs for Spectrin beta 3 Antibody (NBP2-48794)

Learn more about PTMs related to Spectrin beta 3 Antibody (NBP2-48794).
 

Research Areas for Spectrin beta 3 Antibody (NBP2-48794)

Find related products by research area.

Blogs on Spectrin beta 3

There are no specific blogs for Spectrin beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spectrin beta 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN2
Entrez