Tau tubulin kinase 2 Antibody

Images

 
Western Blot: Tau tubulin kinase 2 Antibody [NBP1-92476] - Analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tau tubulin kinase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
Specificity
Specificity of human Tau tubulin kinase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTBK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, IP reactivity reported in (PMID : 24982133).
Control Peptide
Tau tubulin kinase 2 Recombinant Protein Antigen (NBP1-92476PEP)
Publications
Read Publications using
NBP1-92476 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24982133). Mouse reactivity reported in the scientific literature (PMID: 25599390).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tau tubulin kinase 2 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0847tau-tubulin kinase 2
  • SCA11
  • spinocerebellar ataxia 11
  • tau tubulin kinase 2
  • TTBK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NB110-58346
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
H00003748-M01
Species: Hu, Mu, Rb
Applications: WB, ELISA, ICC/IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-97748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31768
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-20338
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30872
Species: Hu
Applications: IHC, IHC-P
NBP2-93821
Species: Hu, Rt
Applications: WB

Publications for Tau tubulin kinase 2 Antibody (NBP1-92476)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IP.


Filter By Application
ICC/IF
(2)
IP
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Tau tubulin kinase 2 Antibody (NBP1-92476) (0)

There are no reviews for Tau tubulin kinase 2 Antibody (NBP1-92476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tau tubulin kinase 2 Antibody (NBP1-92476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tau tubulin kinase 2 Products

Bioinformatics Tool for Tau tubulin kinase 2 Antibody (NBP1-92476)

Discover related pathways, diseases and genes to Tau tubulin kinase 2 Antibody (NBP1-92476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tau tubulin kinase 2 Antibody (NBP1-92476)

Discover more about diseases related to Tau tubulin kinase 2 Antibody (NBP1-92476).
 

Pathways for Tau tubulin kinase 2 Antibody (NBP1-92476)

View related products by pathway.

PTMs for Tau tubulin kinase 2 Antibody (NBP1-92476)

Learn more about PTMs related to Tau tubulin kinase 2 Antibody (NBP1-92476).
 

Research Areas for Tau tubulin kinase 2 Antibody (NBP1-92476)

Find related products by research area.

Blogs on Tau tubulin kinase 2

There are no specific blogs for Tau tubulin kinase 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tau tubulin kinase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTBK2