Tau tubulin kinase 2 Antibody

Western Blot: Tau tubulin kinase 2 Antibody [NBP1-92476] - Analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human skeletal muscle shows very weak positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tau tubulin kinase 2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TTBK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, IP reactivity reported in (PMID : 24982133).
• Control Peptide:

  Tau tubulin kinase 2 Recombinant Protein Antigen (NBP1-92476PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24982133). Mouse reactivity reported in scientific literature (PMID: 25599390).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tau tubulin kinase 2 Antibody

• EC 2.7.11
• EC 2.7.11.1
• KIAA0847tau-tubulin kinase 2
• SCA11
• spinocerebellar ataxia 11
• tau tubulin kinase 2
• TTBK

Background

The Tau tubulin kinase 2 gene encodes a serine-threonine kinase that putatively phosphorylates tau and tubulin proteins. Mutations in thisgene cause spinocerebellar ataxia type 11 (SCA11); a neurodegenerative disease characterized by progressive ataxia andatrophy of the cere

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tau tubulin kinase 2 Antibody (NBP1-92476)(2)

Publications using NBP1-92476

• .Bangs FK, Schrode N, Hadjantonakis AK, Anderson KV. Lineage specificity of primary cilia in the mouse embryo. Nat Cell Biol 2015-02-01 [PMID: 25599390] (ICC/IF, Mouse)
• Cajanek L, Nigg EA. Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole. Proc Natl Acad Sci U S A 2014-07-15 [PMID: 24982133] (ICC/IF, IP, Human)

Bioinformatics

• Gene Symbol: TTBK2