Spectrin beta 2 Recombinant Protein Antigen

Images

 
There are currently no images for Spectrin beta 2 Protein (NBP1-86468PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Spectrin beta 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPTBN1.

Source: E. coli

Amino Acid Sequence: SLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPTBN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86468.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Spectrin beta 2 Recombinant Protein Antigen

  • beta-fodrin
  • beta-G spectrin
  • Beta-II spectrin
  • beta-spectrin 2
  • beta-spectrin II
  • betaSpII
  • ELF
  • embryonic liver beta-fodrin
  • Fodrin beta chain
  • spectrin beta chain, brain 1
  • spectrin, beta, non-erythrocytic 1
  • Spectrin, non-erythroid beta chain 1
  • SPTB2

Background

Spectrin Beta 2 is a major constituent of the erythrocyte skeleton. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface, and transmembrane movement of phospholipids and cholesterol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY4517-05
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-53093
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DY417
Species: Mu
Applications: ELISA
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP1-86468PEP
Species: Hu
Applications: AC

Publications for Spectrin beta 2 Protein (NBP1-86468PEP) (0)

There are no publications for Spectrin beta 2 Protein (NBP1-86468PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 2 Protein (NBP1-86468PEP) (0)

There are no reviews for Spectrin beta 2 Protein (NBP1-86468PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Spectrin beta 2 Protein (NBP1-86468PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Spectrin beta 2 Products

Research Areas for Spectrin beta 2 Protein (NBP1-86468PEP)

Find related products by research area.

Blogs on Spectrin beta 2

There are no specific blogs for Spectrin beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Spectrin beta 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN1