SNAP43 Antibody

Images

 
Western Blot: SNAP43 Antibody [NBP2-88319] - WB Suggested Anti-SNAPC1 Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T
Immunohistochemistry: SNAP43 Antibody [NBP2-88319] - Human Pancrease

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNAP43 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human SNAP43. Peptide sequence: KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNAPC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for SNAP43 Antibody

  • Proximal sequence element-binding transcription factor subunit gamma
  • PSE-binding factor subunit gamma
  • PTF subunit gamma
  • PTFgamma
  • small nuclear RNA activating complex, polypeptide 1, 43kD
  • small nuclear RNA activating complex, polypeptide 1, 43kDa
  • Small nuclear RNA-activating complex polypeptide 1
  • SNAP43SNAPc 43 kDa subunit
  • SNAPc subunit 1
  • snRNA-activating protein complex 43 kDa subunit
  • snRNA-activating protein complex subunit 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57713
Species: Hu
Applications: ICC/IF, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00006621-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-10291
Species: Hu
Applications: IHC, WB
NBP3-04686
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
D6050
Species: Hu
Applications: ELISA
NBP2-83654
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP2-15617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: ICC/IF, WB
H00009013-T01
Species: Hu
Applications: WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for SNAP43 Antibody (NBP2-88319) (0)

There are no publications for SNAP43 Antibody (NBP2-88319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP43 Antibody (NBP2-88319) (0)

There are no reviews for SNAP43 Antibody (NBP2-88319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAP43 Antibody (NBP2-88319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAP43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAPC1