SART2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SART2 Antibody [NBP1-87962] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SART2 Antibody [NBP1-87962] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SART2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SART2 Protein (NBP1-87962PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SART2 Antibody

  • Chondroitin-glucuronate 5-epimerase
  • dermatan sulfate epimerase
  • dermatan-sulfate epimerase
  • DSEPI
  • EC 5.1.3.19
  • SART-2
  • SART2DS epimerase
  • squamous cell carcinoma antigen recognized by T cells 2
  • Squamous cell carcinoma antigen recognized by T-cells 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF6387
Species: Hu
Applications: WB
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB

Publications for SART2 Antibody (NBP1-87962) (0)

There are no publications for SART2 Antibody (NBP1-87962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SART2 Antibody (NBP1-87962) (0)

There are no reviews for SART2 Antibody (NBP1-87962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SART2 Antibody (NBP1-87962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SART2 Products

Bioinformatics Tool for SART2 Antibody (NBP1-87962)

Discover related pathways, diseases and genes to SART2 Antibody (NBP1-87962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SART2 Antibody (NBP1-87962)

Discover more about diseases related to SART2 Antibody (NBP1-87962).
 

Pathways for SART2 Antibody (NBP1-87962)

View related products by pathway.

PTMs for SART2 Antibody (NBP1-87962)

Learn more about PTMs related to SART2 Antibody (NBP1-87962).

Blogs on SART2

There are no specific blogs for SART2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SART2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSE