SPDEF Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SPDEF Antibody [NBP2-56499] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPDEF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPDEF Antibody - BSA Free (NBP2-56499) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPDEF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SPDEF Recombinant Protein Antigen (NBP2-56499PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPDEF Antibody - BSA Free

• bA375E1.3
• PDEFRP11-375E1__A.3
• Prostate epithelium-specific Ets transcription factor
• Prostate-derived Ets factor
• Prostate-specific Ets
• PSE
• SAM pointed domain containing ets transcription factor
• SAM pointed domain-containing Ets transcription factor

Background

SPDEF - SAM pointed domain containing ets transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPDEF