SPCS2 Antibody

Images

 
Western Blot: SPCS2 Antibody [NBP1-93656] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: SPCS2 Antibody [NBP1-93656] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells and cells in seminiferus ducts.
Western Blot: SPCS2 Antibody [NBP1-93656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPCS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAK
Specificity
Specificity of human, mouse, rat SPCS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPCS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPCS2 Antibody

  • MGC117366
  • signal peptidase complex subunit 2 homolog (S. cerevisiae)
  • signal peptidase complex subunit 2
  • SPC25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-338
Species: Hu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP2-66212
Species: Hu
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-92433
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52937
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-2364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80774
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65864
Species: Hu
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, ICC
NBP1-81280
Species: Hu
Applications: IHC, IHC-P

Publications for SPCS2 Antibody (NBP1-93656) (0)

There are no publications for SPCS2 Antibody (NBP1-93656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPCS2 Antibody (NBP1-93656) (0)

There are no reviews for SPCS2 Antibody (NBP1-93656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPCS2 Antibody (NBP1-93656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPCS2 Products

Array NBP1-93656

Bioinformatics Tool for SPCS2 Antibody (NBP1-93656)

Discover related pathways, diseases and genes to SPCS2 Antibody (NBP1-93656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPCS2

There are no specific blogs for SPCS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPCS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPCS2