SPCS2 Antibody - BSA Free

Western Blot: SPCS2 Antibody [NBP1-93656] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human Lymph node shows strong granular cytoplasmic positivity in non-germinal center cells.

Western Blot: SPCS2 Antibody [NBP1-93656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells and cells in seminiferus ducts.

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human Colon shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human Epididymis shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SPCS2 Antibody [NBP1-93656] - Staining of human Pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Staining of human cell line U-2 OS shows localization to nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPCS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPCS2 Antibody - BSA Free (NBP1-93656) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPCS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SPCS2 Protein (NBP1-93656PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPCS2 Antibody - BSA Free

• MGC117366
• signal peptidase complex subunit 2 homolog (S. cerevisiae)
• signal peptidase complex subunit 2
• SPC25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPCS2