SPATA9 Antibody


Western Blot: SPATA9 Antibody [NBP1-59840] - U937 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SPATA9 Antibody Summary

Synthetic peptides corresponding to SPATA9 (spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9)(50ug). Peptide sequence FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPATA9 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPATA9 Antibody

  • FLJ35906
  • NYD-SP16
  • spermatogenesis associated 9
  • spermatogenesis-associated protein 9
  • Testis development protein NYD-SP16


SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Species: Hu
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB

Publications for SPATA9 Antibody (NBP1-59840) (0)

There are no publications for SPATA9 Antibody (NBP1-59840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA9 Antibody (NBP1-59840) (0)

There are no reviews for SPATA9 Antibody (NBP1-59840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA9 Antibody (NBP1-59840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPATA9 Products

Bioinformatics Tool for SPATA9 Antibody (NBP1-59840)

Discover related pathways, diseases and genes to SPATA9 Antibody (NBP1-59840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA9 Antibody (NBP1-59840)

Discover more about diseases related to SPATA9 Antibody (NBP1-59840).

Blogs on SPATA9

There are no specific blogs for SPATA9, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPATA9 Antibody and receive a gift card or discount.


Gene Symbol SPATA9
COVID-19 update