CCDC38 Antibody


Western Blot: CCDC38 Antibody [NBP1-56363] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CCDC38 Antibody Summary

Synthetic peptides corresponding to CCDC38(coiled-coil domain containing 38) The peptide sequence was selected from the N terminal of CCDC38. Peptide sequence RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CCDC38 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCDC38 Antibody

  • coiled-coil domain containing 38
  • coiled-coil domain-containing protein 38
  • FLJ40089


The specific function of CCDC38 is not yet known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Species: Hu
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for CCDC38 Antibody (NBP1-56363) (0)

There are no publications for CCDC38 Antibody (NBP1-56363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC38 Antibody (NBP1-56363) (0)

There are no reviews for CCDC38 Antibody (NBP1-56363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC38 Antibody (NBP1-56363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC38 Products

CCDC38 NBP1-56363

Bioinformatics Tool for CCDC38 Antibody (NBP1-56363)

Discover related pathways, diseases and genes to CCDC38 Antibody (NBP1-56363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC38 Antibody (NBP1-56363)

Discover more about diseases related to CCDC38 Antibody (NBP1-56363).

Blogs on CCDC38

There are no specific blogs for CCDC38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC38 Antibody and receive a gift card or discount.


Gene Symbol CCDC38