SPAG16 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SPAG16 Antibody [NBP1-84124] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.

Staining of human testis shows strong cytoplasmic granular positivity in seminiferous ducts.

Analysis in human cell line SH-SY5Y.

Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.

Staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.

Staining of human breast shows strong cytoplasmic granular positivity in glandular cells).

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPAG16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPAG16 Antibody - BSA Free (NBP1-84124) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPAG16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SPAG16 Protein (NBP1-84124PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPAG16 Antibody - BSA Free

• DKFZp666P1710
• FLJ22724
• FLJ37717
• Pf20 protein homolog
• PF20MGC87036
• sperm associated antigen 16
• sperm-associated antigen 16 protein
• sperm-associated WD repeat protein
• WD repeat domain 29
• WDR29

Background

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPAG16