SPAG16 Antibody

Images

 
Western Blot: SPAG16 Antibody [NBP1-84124] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SPAG16 Antibody [NBP1-84124] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: SPAG16 Antibody [NBP1-84124] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPAG16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPAG16 Protein (NBP1-84124PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPAG16 Antibody

  • DKFZp666P1710
  • FLJ22724
  • FLJ37717
  • Pf20 protein homolog
  • PF20MGC87036
  • sperm associated antigen 16
  • sperm-associated antigen 16 protein
  • sperm-associated WD repeat protein
  • WD repeat domain 29
  • WDR29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-93840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94132
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55519
Species: Hu
Applications: ICC/IF
AF1936
Species: Hu
Applications: WB, IP
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-47266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SPAG16 Antibody (NBP1-84124) (0)

There are no publications for SPAG16 Antibody (NBP1-84124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG16 Antibody (NBP1-84124) (0)

There are no reviews for SPAG16 Antibody (NBP1-84124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPAG16 Antibody (NBP1-84124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPAG16 Products

Bioinformatics Tool for SPAG16 Antibody (NBP1-84124)

Discover related pathways, diseases and genes to SPAG16 Antibody (NBP1-84124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG16 Antibody (NBP1-84124)

Discover more about diseases related to SPAG16 Antibody (NBP1-84124).
 

Pathways for SPAG16 Antibody (NBP1-84124)

View related products by pathway.

Blogs on SPAG16

There are no specific blogs for SPAG16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPAG16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG16