SP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SP4 Antibody [NBP2-31983] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry: SP4 Antibody [NBP2-31983] - Staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SP4 Protein (NBP2-31983PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP4 Antibody

  • MGC130008
  • MGC130009
  • Sp4 transcription factor
  • SPR-1HF1B
  • transcription factor Sp4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
AF4256
Species: Hu
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-83714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79438
Species: Hu
Applications: WB
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56340
Species: Hu
Applications: ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for SP4 Antibody (NBP2-31983) (0)

There are no publications for SP4 Antibody (NBP2-31983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP4 Antibody (NBP2-31983) (0)

There are no reviews for SP4 Antibody (NBP2-31983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SP4 Antibody (NBP2-31983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP4 Products

Bioinformatics Tool for SP4 Antibody (NBP2-31983)

Discover related pathways, diseases and genes to SP4 Antibody (NBP2-31983). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP4 Antibody (NBP2-31983)

Discover more about diseases related to SP4 Antibody (NBP2-31983).
 

Pathways for SP4 Antibody (NBP2-31983)

View related products by pathway.

PTMs for SP4 Antibody (NBP2-31983)

Learn more about PTMs related to SP4 Antibody (NBP2-31983).

Blogs on SP4.

Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP4
Uniprot