ZBTB10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZBTB10 Antibody [NBP1-83714] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZBTB10 Antibody [NBP1-83714] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZBTB10 Protein (NBP1-83714PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB10 Antibody

  • RINZFC
  • zinc finger and BTB domain containing 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-83714
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZBTB10 Antibody (NBP1-83714) (0)

There are no publications for ZBTB10 Antibody (NBP1-83714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB10 Antibody (NBP1-83714) (0)

There are no reviews for ZBTB10 Antibody (NBP1-83714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZBTB10 Antibody (NBP1-83714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB10 Products

Bioinformatics Tool for ZBTB10 Antibody (NBP1-83714)

Discover related pathways, diseases and genes to ZBTB10 Antibody (NBP1-83714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB10 Antibody (NBP1-83714)

Discover more about diseases related to ZBTB10 Antibody (NBP1-83714).
 

Pathways for ZBTB10 Antibody (NBP1-83714)

View related products by pathway.

PTMs for ZBTB10 Antibody (NBP1-83714)

Learn more about PTMs related to ZBTB10 Antibody (NBP1-83714).

Blogs on ZBTB10

There are no specific blogs for ZBTB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB10