SP17 Antibody

Images

 
Western Blot: SP17 Antibody [NBP1-85409] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: SP17 Antibody [NBP1-85409] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: SP17 Antibody [NBP1-85409] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPA17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SP17 Recombinant Protein Antigen (NBP1-85409PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP17 Antibody

  • Cancer/testis antigen 22
  • CT22SP17-1
  • Sp17-1
  • SP17sperm surface protein Sp17
  • sperm autoantigenic protein 17Sperm protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-89173
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47924
Species: Hu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SP17 Antibody (NBP1-85409) (0)

There are no publications for SP17 Antibody (NBP1-85409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP17 Antibody (NBP1-85409) (0)

There are no reviews for SP17 Antibody (NBP1-85409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SP17 Antibody (NBP1-85409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP17 Products

Bioinformatics Tool for SP17 Antibody (NBP1-85409)

Discover related pathways, diseases and genes to SP17 Antibody (NBP1-85409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP17 Antibody (NBP1-85409)

Discover more about diseases related to SP17 Antibody (NBP1-85409).
 

Pathways for SP17 Antibody (NBP1-85409)

View related products by pathway.

PTMs for SP17 Antibody (NBP1-85409)

Learn more about PTMs related to SP17 Antibody (NBP1-85409).

Blogs on SP17

There are no specific blogs for SP17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPA17