MAGEC1 Antibody

Images

 
Western Blot: MAGEC1 Antibody [NBP1-85397] - Analysis in human cell line U-2 OS and human cell line CACO-2.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and pancreas tissues.. Corresponding MAGEC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human epididymis shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining in human testis and epididymis tissues using anti-MAGEC1 antibody. Corresponding MAGEC1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.
Immunohistochemistry-Paraffin: MAGEC1 Antibody [NBP1-85397] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MAGEC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGEC1 Protein (NBP1-85397PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGEC1 Antibody

  • Cancer/testis antigen 7.1
  • cancer/testis antigen family 7, member 1
  • CT7
  • CT7.1MAGE-C1
  • MAGE-C1 antigen
  • melanoma antigen family C, 1
  • melanoma-associated antigen C1
  • MGC39366

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP2-00614
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-84354
Species: Hu
Applications: ICC/IF, IHC, IHC-P
1129-ER
Species: Hu
Applications: BA
NBP1-85409
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF144
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85397
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MAGEC1 Antibody (NBP1-85397) (0)

There are no publications for MAGEC1 Antibody (NBP1-85397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEC1 Antibody (NBP1-85397) (0)

There are no reviews for MAGEC1 Antibody (NBP1-85397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEC1 Antibody (NBP1-85397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEC1 Products

Bioinformatics Tool for MAGEC1 Antibody (NBP1-85397)

Discover related pathways, diseases and genes to MAGEC1 Antibody (NBP1-85397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEC1 Antibody (NBP1-85397)

Discover more about diseases related to MAGEC1 Antibody (NBP1-85397).
 

Pathways for MAGEC1 Antibody (NBP1-85397)

View related products by pathway.

PTMs for MAGEC1 Antibody (NBP1-85397)

Learn more about PTMs related to MAGEC1 Antibody (NBP1-85397).

Blogs on MAGEC1

There are no specific blogs for MAGEC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC1