SP1 Antibody

Images

 
Western Blot: SP1 Antibody [NBP1-85812] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: SP1 Antibody [NBP1-85812] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SP1 Antibody [NBP1-85812] - Staining of human small intestine shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SP1 Protein (NBP1-85812PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP1 Antibody

  • Sp1 transcription factor
  • specificity protein 1
  • transcription factor Sp1
  • TSFP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB4077
Species: Hu
Applications: WB, IHC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-85812
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SP1 Antibody (NBP1-85812) (0)

There are no publications for SP1 Antibody (NBP1-85812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP1 Antibody (NBP1-85812) (0)

There are no reviews for SP1 Antibody (NBP1-85812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SP1 Antibody (NBP1-85812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP1 Products

Bioinformatics Tool for SP1 Antibody (NBP1-85812)

Discover related pathways, diseases and genes to SP1 Antibody (NBP1-85812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP1 Antibody (NBP1-85812)

Discover more about diseases related to SP1 Antibody (NBP1-85812).
 

Pathways for SP1 Antibody (NBP1-85812)

View related products by pathway.

PTMs for SP1 Antibody (NBP1-85812)

Learn more about PTMs related to SP1 Antibody (NBP1-85812).

Blogs on SP1.

Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP1