SP-D Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SP-D Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFTPD.
  
  

  Source: E. coli

  Amino Acid Sequence: LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SFTPD
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33424.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SP-D Recombinant Protein Antigen

• COLEC7collectin-7
• Collectin 7
• Collectin-7
• Lung surfactant protein D
• PSPD
• PSP-D
• SFTP4
• SFTP4pulmonary surfactant-associated protein D
• SFTPD
• SPD
• SP-D
• SP-Dpulmonary surfactant apoprotein
• surfactant protein D
• surfactant, pulmonary-associated protein D
• surfactant-associated protein, pulmonary 4

Background

Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular head regions linked by triple-helical, collagen-like, strands. This group also includes SP-A and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 88 ng/ml in healthy individuals (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SFTPD