SP-D Antibody - BSA Free

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining in human lung and kidney tissues using anti-SFTPD antibody. Corresponding SFTPD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human cerebral cortex, colon, lung and lymph node using Anti-SFTPD antibody NBP2-38803 (A) shows similar protein distribution across tissues to independent antibody NBP2-33424 (B).

Western Blot: SP-D Antibody [NBP2-38803] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Lung tissue

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human lymph node.

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human lung shows strong cytoplasmic positivity in subset of pneumocytes and macrophages.

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human colon.

Immunohistochemistry-Paraffin: SP-D Antibody [NBP2-38803] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SP-D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SP-D Antibody - BSA Free (NBP2-38803) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SP-D Protein (NBP2-38803PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SP-D Antibody - BSA Free

• COLEC7collectin-7
• Collectin 7
• Collectin-7
• Lung surfactant protein D
• PSPD
• PSP-D
• SFTP4
• SFTP4pulmonary surfactant-associated protein D
• SFTPD
• SPD
• SP-D
• SP-Dpulmonary surfactant apoprotein
• surfactant protein D
• surfactant, pulmonary-associated protein D
• surfactant-associated protein, pulmonary 4

Background

Surfactant protein D (SP-D) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular head regions linked by triple-helical, collagen-like, strands. This group also includes SP-A and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 88 ng/ml in healthy individuals (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFTPD
• Uniprot:
  • P35247()