SOX9 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining in human testis and skeletal muscle tissues. Corresponding SOX9 RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SOX9 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551] - Further analysis of P2X7-EGFP expressing cells in the dentate gyrus and CA1 region. Co-staining of EGFP with the alternative astrocyte marker SOX9 in ...read more
Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human small intestine shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Simple Western: SOX9 Antibody [NBP1-85551] - Simple Western lane view shows a specific band for SOX9 in 0.1 mg/ml of U-251MG sp (left) and HepG2 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: SOX9 Antibody [NBP1-85551] - Electropherogram image(s) of corresponding Simple Western lane view. SOX9 antibody was used at 1:100 dilution on U-251MG sp and HepG2 lysates(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, CaSpecies Glossary
Applications WB, Simple Western, GS, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Marker
Sertoli Cell Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:100
  • Gel Super Shift Assays
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in Gel super shift assays reported in scientific literature (PMID: 26430891). Use in IHC-FR reported in scientific literature (PMID:32103177).
Control Peptide
SOX9 Protein (NBP1-85551PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85551 in the following applications:

Publications
Read Publications using
NBP1-85551 in the following applications:

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33645550). Porcine reactivity reported in scientific Iliterature (PMID: 26430891). Use in Canine reported in scientific literature (PMID:26428883).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX9 Antibody

  • campomelic dysplasia, autosomal sex-reversal
  • CMD 1
  • CMD1
  • CMPD1
  • SOX9
  • SRA1SRY (sex-determining region Y)-box 9 protein
  • SRY (sex determining region Y)-box 9
  • SRY-related HMG-box, gene 9
  • transcription factor SOX-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
AF5286
Species: Hu
Applications: WB
AF2864
Species: Hu
Applications: WB, IHC, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86149
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85551
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-Fr, IHC-P, KD

Publications for SOX9 Antibody (NBP1-85551)(17)

We have publications tested in 6 confirmed species: Human, Mouse, Rat, Canine, Porcine, mouse.

We have publications tested in 5 applications: EMSA, IHC, IHC-P, IHF-Fr, WB.


Filter By Application
EMSA
(1)
IHC
(7)
IHC-P
(1)
IHF-Fr
(1)
WB
(2)
All Applications
Filter By Species
Human
(4)
Mouse
(2)
Rat
(3)
Canine
(1)
Porcine
(1)
mouse
(1)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using NBP1-85551 Applications Species
Liu Q, Guo Q, Guo W et al. Loss of CEP70 function affects acrosome biogenesis and flagella formation during spermiogenesis Cell death & disease May 12 2021 [PMID: 33980814] (IHC, Mouse) IHC Mouse
Winkler A, Wrzos C, Haberl M et al. Blood-brain barrier resealing in neuromyelitis optica occurs independently of astrocyte regeneration The Journal of clinical investigation Mar 1 2021 [PMID: 33645550] (Rat) Rat
Deepe R, Fitzgerald E, Wolters R et al. The Mesenchymal Cap of the Atrial Septum and Atrial and Atrioventricular Septation J Cardiovasc Dev Dis Nov 4 2020 [PMID: 33158164] (IHC, mouse) IHC mouse
van Gastel N, Stegen S, Eelen G et al. Lipid availability determines fate of skeletal progenitor cells via SOX9 Nature Feb 26 2020 [PMID: 32103177] (IHC-P, IHF-Fr, Mouse) IHC-P, IHF-Fr Mouse
Tournaire G, Stegen S, Giacomini G et al. Nestin-GFP transgene labels skeletal progenitors in the periosteum Bone Apr 1 2020 [PMID: 32036051]
Cheng B, Liu Y, Zhao Y et al. The role of anthrax toxin protein receptor 1 as a new mechanosensor molecule and its mechanotransduction in BMSCs under hydrostatic pressure Sci Rep Sep 2 2019 [PMID: 31477767] (WB, Rat) WB Rat
Roberts RR, Bobzin L, Teng CS et al. FGF signaling patterns cell fate at the interface between tendon and bone Development Jul 18 2019 [PMID: 31320326]
Kaczmarek-Hajek K, Zhang J, Kopp R et al. Re-evaluation of neuronal P2X7 expression using novel mouse models and a P2X7-specific nanobody. Elife Aug 3 2018 [PMID: 30074479] (IHC, Human) IHC Human
Leijten J, Teixeira LS, Bolander J et al. Bioinspired seeding of biomaterials using three dimensional microtissues induces chondrogenic stem cell differentiation and cartilage formation under growth factor free conditions. Sci Rep. Nov 3 2016 [PMID: 27808102] (Human) Human
Brenig B, Duan Y, Xing Y et al. Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region. PLoS One 2015 [PMID: 26430891] (EMSA, Porcine) EMSA Porcine
Show All 17 Publications.

Review for SOX9 Antibody (NBP1-85551) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-85551:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SOX9 NBP1-85551
Enlarge
5
reviewed by:
Verified Customer
WB Human 01/30/2019
View

Summary

ApplicationWestern Blot
Sample Tested293T lysates
SpeciesHuman
LotF115596

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX9 Antibody (NBP1-85551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SOX9 Products

Bioinformatics Tool for SOX9 Antibody (NBP1-85551)

Discover related pathways, diseases and genes to SOX9 Antibody (NBP1-85551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX9 Antibody (NBP1-85551)

Discover more about diseases related to SOX9 Antibody (NBP1-85551).
 

Pathways for SOX9 Antibody (NBP1-85551)

View related products by pathway.

PTMs for SOX9 Antibody (NBP1-85551)

Learn more about PTMs related to SOX9 Antibody (NBP1-85551).
 

Research Areas for SOX9 Antibody (NBP1-85551)

Find related products by research area.

Blogs on SOX9.

Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients
By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

SOX9 - Be careful, I can reverse your gender!
SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st...  Read full blog post.

Using the Hif-1 Alpha Antibody in Prostate Cancer Research
The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
01/30/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol SOX9
Entrez
Uniprot