SOX9 Antibody

Images

 
Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX9 antibody. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in human cell line HepG2.
Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Immunohistochemical staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Immunohistochemical staining of human small intestine shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Simple Western: SOX9 Antibody [NBP1-85551] - Simple Western lane view shows a specific band for SOX9 in 0.1 mg/ml of U-251MG sp (left) and HepG2 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: SOX9 Antibody [NBP1-85551] - Electropherogram image(s) of corresponding Simple Western lane view. SOX9 antibody was used at 1:100 dilution on U-251MG sp and HepG2 lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Marker
Sertoli Cell Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:100
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SOX9 Protein (NBP1-85551PEP)
Publications
Read Publications using
NBP1-85551 in the following applications:

  • 1 publication
  • 1 publication
  • IHC
    5 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24556689)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX9 Antibody

  • campomelic dysplasia, autosomal sex-reversal
  • CMD 1
  • CMD1
  • CMPD1
  • SOX9
  • SRA1SRY (sex-determining region Y)-box 9 protein
  • SRY (sex determining region Y)-box 9
  • SRY-related HMG-box, gene 9
  • transcription factor SOX-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF5286
Species: Hu
Applications: WB
AF2864
Species: Hu
Applications: WB, ICC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SOX9 Antibody (NBP1-85551)(10)

We have publications tested in 5 confirmed species: Human, Mouse, Rat, Canine, Porcine.

We have publications tested in 4 applications: EMSA, ICC/IF, IHC, WB.


Filter By Application
EMSA
(1)
ICC/IF
(1)
IHC
(5)
WB
(1)
All Applications
Filter By Species
Human
(3)
Mouse
(1)
Rat
(1)
Canine
(1)
Porcine
(1)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-85551 Applications Species
Leijten J, Teixeira LS, Bolander J et al. Bioinspired seeding of biomaterials using three dimensional microtissues induces chondrogenic stem cell differentiation and cartilage formation under growth factor free conditions. Sci Rep. Nov 3 2016 [PMID: 27808102] (Human) Human
Brenig B, Duan Y, Xing Y et al. Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region. PLoS One 2015 [PMID: 26430891] (EMSA, Porcine) EMSA Porcine
Fantinato E, Milani L, Sironi G. Sox9 Expression in Canine Epithelial Skin Tumors. Eur J Histochem 2015 Jul 9 [PMID: 26428883] (IHC, Canine) IHC Canine
Chen YH, Chen HL, Chien CS et al. Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury. PLoS One 2015 [PMID: 26308208] (IHC, Rat) IHC Rat
Roy N, Malik S, Villanueva KE et al. Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation. Genes Dev 2015 Mar 15 [PMID: 25792600] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Capaccione KM, Hong X, Morgan KM et al. Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma. Oncotarget 2014 Jun 15 [PMID: 25004243] (IHC, WB, Human) IHC, WB Human
Bruun J, Kolberg M, Nesland JM et al. Prognostic Significance of beta-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series. Front Oncol 2014 [PMID: 24904831]
Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014 Apr 5 [PMID: 24708576] (IHC, Human) IHC Human
Poulsen RC, Knowles HJ, Carr AJ et al. Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure. Cell Death Dis 2014 Feb 20 [PMID: 24556689]
Vestentoft PS et al. Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver. BMC Dev Biol;11:56. 2011 Sep 26. [PMID: 21943389]

Reviews for SOX9 Antibody (NBP1-85551) (0)

There are no reviews for SOX9 Antibody (NBP1-85551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX9 Antibody (NBP1-85551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX9 Products

Bioinformatics Tool for SOX9 Antibody (NBP1-85551)

Discover related pathways, diseases and genes to SOX9 Antibody (NBP1-85551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX9 Antibody (NBP1-85551)

Discover more about diseases related to SOX9 Antibody (NBP1-85551).
 

Pathways for SOX9 Antibody (NBP1-85551)

View related products by pathway.

PTMs for SOX9 Antibody (NBP1-85551)

Learn more about PTMs related to SOX9 Antibody (NBP1-85551).
 

Research Areas for SOX9 Antibody (NBP1-85551)

Find related products by research area.

Blogs on SOX9.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

SOX9 - Be careful, I can reverse your gender!
SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st...  Read full blog post.

Using the Hif-1 Alpha Antibody in Prostate Cancer Research
The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX9
Entrez
Uniprot