SOX6 Antibody

Images

 
Western Blot: SOX6 Antibody [NBP1-86149] - Analysis in control (vector only transfected HEK293T lysate) and SOX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining in human testis and endometrium tissues using anti-SOX6 antibody. Corresponding SOX6 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SOX6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SOX6 Protein (NBP1-86149PEP)
Publications
Read Publications using NBP1-86149.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX6 Antibody

  • HSSOX6
  • SOX6
  • SOXD
  • SRY (sex determining region Y)-box 6
  • SRY-box containing gene 6
  • transcription factor SOX-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5286
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF2864
Species: Hu
Applications: ICC, IHC, WB
AF1705
Species: Mu
Applications: IHC, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
MAB7547
Species: Hu
Applications: ICC, WB
1206-F3/CF
Species: Hu
Applications: BA
H00005607-P01
Species: Hu
Applications: ELISA, Func, AP, IP, PA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DY805
Species: Hu
Applications: ELISA

Publications for SOX6 Antibody (NBP1-86149)(2)

Reviews for SOX6 Antibody (NBP1-86149) (0)

There are no reviews for SOX6 Antibody (NBP1-86149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX6 Antibody (NBP1-86149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX6 Products

Bioinformatics Tool for SOX6 Antibody (NBP1-86149)

Discover related pathways, diseases and genes to SOX6 Antibody (NBP1-86149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX6 Antibody (NBP1-86149)

Discover more about diseases related to SOX6 Antibody (NBP1-86149).
 

Pathways for SOX6 Antibody (NBP1-86149)

View related products by pathway.

PTMs for SOX6 Antibody (NBP1-86149)

Learn more about PTMs related to SOX6 Antibody (NBP1-86149).

Blogs on SOX6

There are no specific blogs for SOX6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX6