SOX7 Antibody - BSA Free

Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-86116] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-86116] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-86116] - Staining of human Placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-86116] - Staining of human Prostate shows strong nuclear and cytoplasmic positivity in glandular cells.

Analysis in human cell line A-431.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOX7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOX7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SOX7 Protein (NBP1-86116PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23557216)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SOX7 Antibody - BSA Free

• MGC10895
• SOX7 transcription factor
• SOX7
• SRY (sex determining region Y)-box 7
• transcription factor SOX-7

Background

SOX7 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOX7 Antibody (NBP1-86116)(2)

Publications using NBP1-86116

• Hayano T, Garg M, Yin D et al. SOX7 is down-regulated in lung cancer. J Exp Clin Cancer Res 2013-04-04 [PMID: 23557216]
• Saegusa M, Hashimura M, Kuwata T et al. Sox4 functions as a positive regulator of Beta -catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Lab Invest 2012-04-01 [PMID: 22231735]

Bioinformatics

• Gene Symbol: SOX7