SOX7 Antibody

Images

 
Western Blot: SOX7 Antibody [NBP1-80374] - Human Fetal Stomach Cell Lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-80374] - Transfected 293T cell lysate, 0.25 ug/ml. Gel concentration 15%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX7 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SOX7. Peptide sequence LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SOX7 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOX7 Antibody

  • MGC10895
  • SOX7 transcription factor
  • SOX7
  • SRY (sex determining region Y)-box 7
  • transcription factor SOX-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
AF5077
Species: Hu
Applications: WB
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2569
Species: Hu
Applications: WB, ICC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80374
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SOX7 Antibody (NBP1-80374) (0)

There are no publications for SOX7 Antibody (NBP1-80374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX7 Antibody (NBP1-80374) (0)

There are no reviews for SOX7 Antibody (NBP1-80374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX7 Antibody (NBP1-80374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX7 Products

Bioinformatics Tool for SOX7 Antibody (NBP1-80374)

Discover related pathways, diseases and genes to SOX7 Antibody (NBP1-80374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX7 Antibody (NBP1-80374)

Discover more about diseases related to SOX7 Antibody (NBP1-80374).
 

Pathways for SOX7 Antibody (NBP1-80374)

View related products by pathway.

PTMs for SOX7 Antibody (NBP1-80374)

Learn more about PTMs related to SOX7 Antibody (NBP1-80374).

Blogs on SOX7

There are no specific blogs for SOX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX7
Entrez
Uniprot