SOX7 Antibody


Western Blot: SOX7 Antibody [NBP1-80374] - Human Fetal Stomach Cell Lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-80374] - Transfected 293T cell lysate, 0.25 ug/ml. Gel concentration 15%

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SOX7 Antibody Summary

Synthetic peptide directed towards the middle region of human SOX7. Peptide sequence LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SOX7 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOX7 Antibody

  • MGC10895
  • SOX7 transcription factor
  • SOX7
  • SRY (sex determining region Y)-box 7
  • transcription factor SOX-7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, IHC, ChIP, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, ICC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SOX7 Antibody (NBP1-80374) (0)

There are no publications for SOX7 Antibody (NBP1-80374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX7 Antibody (NBP1-80374) (0)

There are no reviews for SOX7 Antibody (NBP1-80374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX7 Antibody (NBP1-80374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SOX7 Products

Bioinformatics Tool for SOX7 Antibody (NBP1-80374)

Discover related pathways, diseases and genes to SOX7 Antibody (NBP1-80374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX7 Antibody (NBP1-80374)

Discover more about diseases related to SOX7 Antibody (NBP1-80374).

Pathways for SOX7 Antibody (NBP1-80374)

View related products by pathway.

PTMs for SOX7 Antibody (NBP1-80374)

Learn more about PTMs related to SOX7 Antibody (NBP1-80374).

Blogs on SOX7

There are no specific blogs for SOX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SOX7 Antibody and receive a gift card or discount.


Gene Symbol SOX7