SOX5 Antibody

Images

 
Western Blot: SOX5 Antibody [NBP1-74096] - Sample Tissue: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/ml, Peptide Concentration: ...read more
Western Blot: SOX5 Antibody [NBP1-74096] - Dilution: 1 ug/ml on Hela cell lysate.
Western Blot: SOX5 Antibody [NBP1-74096] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX5 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of SOX5 (NP_821078). Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SOX5 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOX5 Antibody

  • L-SOX5
  • MGC35153
  • SOX5
  • SRY (sex determining region Y)-box 5
  • transcription factor SOX-5

Background

SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-86149
Species: Hu
Applications: IHC, IHC-P, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF2864
Species: Hu
Applications: ICC, IHC, WB
MAB7547
Species: Hu
Applications: ICC, WB
AF1705
Species: Mu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-61421
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
MAB6734
Species: Hu
Applications: IHC
AF5077
Species: Hu
Applications: WB
NBP3-12898
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-74096
Species: Hu
Applications: WB

Publications for SOX5 Antibody (NBP1-74096) (0)

There are no publications for SOX5 Antibody (NBP1-74096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX5 Antibody (NBP1-74096) (0)

There are no reviews for SOX5 Antibody (NBP1-74096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX5 Antibody (NBP1-74096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX5 Products

Bioinformatics Tool for SOX5 Antibody (NBP1-74096)

Discover related pathways, diseases and genes to SOX5 Antibody (NBP1-74096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX5 Antibody (NBP1-74096)

Discover more about diseases related to SOX5 Antibody (NBP1-74096).
 

Pathways for SOX5 Antibody (NBP1-74096)

View related products by pathway.

PTMs for SOX5 Antibody (NBP1-74096)

Learn more about PTMs related to SOX5 Antibody (NBP1-74096).

Blogs on SOX5

There are no specific blogs for SOX5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX5
Entrez
Uniprot