| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Endotoxin, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 45-136 of Human SOX4 Source: Wheat Germ (in vitro) Amino Acid Sequence: KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | SOX4 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 35.86 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00006659-Q01 | Applications | Species |
|---|---|---|
| Ognjenovic NB, Bagheri M, Mohamed GA et al. Limiting Self-Renewal of the Basal Compartment by PKA Activation Induces Differentiation and Alters the Evolution of Mammary Tumors Dev Cell 2020-10-22 [PMID: 33120014] |
Research Areas for SOX4 Partial Recombinant Protein (H00006659-Q01)Find related products by research area.
|
|
Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SOX4 |