SORBS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SORBS2 Antibody [NBP2-32672] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: SORBS2 Antibody [NBP2-32672] - Staining of human heart muscle shows strong nuclear and moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SORBS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORBS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SORBS2 Protein (NBP2-32672PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SORBS2 Antibody

  • Arg/Abl interacting protein
  • Arg/Abl-interacting protein 2
  • ArgBP2
  • ARGBP2PRO0618
  • FLJ93447
  • KIAA0777Arg binding protein 2
  • sorbin and SH3 domain containing 2
  • sorbin and SH3 domain-containing protein 2
  • Sorbin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-20861
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
AF5514
Species: Hu, Mu
Applications: WB
NBL1-14964
Species: Hu
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-49154
Species: Hu
Applications: IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32672
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SORBS2 Antibody (NBP2-32672) (0)

There are no publications for SORBS2 Antibody (NBP2-32672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SORBS2 Antibody (NBP2-32672) (0)

There are no reviews for SORBS2 Antibody (NBP2-32672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SORBS2 Antibody (NBP2-32672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SORBS2 Products

Bioinformatics Tool for SORBS2 Antibody (NBP2-32672)

Discover related pathways, diseases and genes to SORBS2 Antibody (NBP2-32672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SORBS2 Antibody (NBP2-32672)

Discover more about diseases related to SORBS2 Antibody (NBP2-32672).
 

Pathways for SORBS2 Antibody (NBP2-32672)

View related products by pathway.

PTMs for SORBS2 Antibody (NBP2-32672)

Learn more about PTMs related to SORBS2 Antibody (NBP2-32672).
 

Research Areas for SORBS2 Antibody (NBP2-32672)

Find related products by research area.

Blogs on SORBS2

There are no specific blogs for SORBS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SORBS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SORBS2