Sonic Hedgehog/Shh Antibody


Western Blot: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Lane A: Marker; Lane B HepG2 Cell Lysate. Antibody titration 1.0ug/ml. Gel concentration 12%
Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Chicken embryos Primary Antibody: 1 : 1000 (ARP44235_p050) anti -shh Secondary Antibody: 1 : 500 (ASP00001) goat anti-rabbit HRP conjugated.
Immunohistochemistry-Paraffin: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human Intestine cells with positive label: Epithelial cells of intestinal villus (indicated with arrows). Concentration 4.0-8.0 ug/ml
Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human glioma cells. Primary Antibody Dilution :1:200 Secondary Antibody :Anti-rabbit-GFP. Secondary Antibody Dilution :1:500. Color/Signal Descriptions more

Product Details

Reactivity Hu, ChSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Sonic Hedgehog/Shh Antibody Summary

Synthetic peptides corresponding to SHH(sonic hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-69270.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sonic Hedgehog/Shh Antibody

  • HHG1
  • HHG-1
  • HLP3
  • HPE3
  • MCOPCB5sonic hedgehog (Drosophila) homolog
  • Shh
  • SMMCIsonic hedgehog homolog (Drosophila)
  • sonic hedgehog homolog
  • sonic hedgehog protein
  • Sonic Hedgehog
  • TPT


SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P

Publications for Sonic Hedgehog/Shh Antibody (NBP1-69270)(1)

Reviews for Sonic Hedgehog/Shh Antibody (NBP1-69270) (0)

There are no reviews for Sonic Hedgehog/Shh Antibody (NBP1-69270). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sonic Hedgehog/Shh Antibody (NBP1-69270). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in using your sonic hedgehog antibody on paraffin-sections of mouse tissue. Do you have a protocol and references for this? Do you offer a sample size product to try?
    • In regards to your inquiry about the Sonic Hedgehog antibody and its use in IHC-P for mouse samples. Unfortunately we do not have any specific reference yet reported for this one to provide. Here is a link to our lab's recommended Immunohistochemistry-Paraffin Protocol. We only have the one size available so there is no sample size associated with this antibody.

Secondary Antibodies


Isotype Controls

Additional Sonic Hedgehog/Shh Products

Bioinformatics Tool for Sonic Hedgehog/Shh Antibody (NBP1-69270)

Discover related pathways, diseases and genes to Sonic Hedgehog/Shh Antibody (NBP1-69270). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sonic Hedgehog/Shh Antibody (NBP1-69270)

Discover more about diseases related to Sonic Hedgehog/Shh Antibody (NBP1-69270).

Pathways for Sonic Hedgehog/Shh Antibody (NBP1-69270)

View related products by pathway.

PTMs for Sonic Hedgehog/Shh Antibody (NBP1-69270)

Learn more about PTMs related to Sonic Hedgehog/Shh Antibody (NBP1-69270).

Research Areas for Sonic Hedgehog/Shh Antibody (NBP1-69270)

Find related products by research area.

Blogs on Sonic Hedgehog/Shh

There are no specific blogs for Sonic Hedgehog/Shh, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sonic Hedgehog/Shh Antibody and receive a gift card or discount.


Gene Symbol SHH