Sonic Hedgehog/Shh Antibody (8T4D3)

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Analysis of extracts of various cell lines, using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Immunofluorescence analysis of Hep G2 cells using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: Sonic Hedgehog/Shh Antibody (8T4D3) [NBP3-15454] - Analysis of extracts of various cell lines, using Sonic Hedgehog/Shh (Shh) Rabbit mAb (NBP3-15454) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] - Confocal imaging of paraffin-embedded Mouse kidney using Sonic Hedgehog/Shh Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Sonic Hedgehog/Shh Antibody (8T4D3) [Sonic Hedgehog/Shh] - Confocal imaging of Hep G2 cells using Sonic Hedgehog/Shh Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 8T4D3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Sonic Hedgehog/Shh Antibody (8T4D3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog/Shh (Q15465). PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SHH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sonic Hedgehog/Shh Antibody (8T4D3)

• HHG1
• HHG-1
• HLP3
• HPE3
• MCOPCB5
• MCOPCB5sonic hedgehog (Drosophila) homolog
• Shh
• ShhNC
• SMMCI
• SMMCIsonic hedgehog homolog (Drosophila)
• sonic hedgehog homolog
• sonic hedgehog protein
• Sonic Hedgehog
• TPT
• TPTPS

Background

Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal (1). Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene (2). Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo (3). A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHH