Somatostatin Antibody - BSA Free

Immunohistochemistry-Paraffin: Somatostatin Antibody [NBP2-93171] - Human appendix using Somatostatin (SST) antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Somatostatin Antibody [NBP2-93171] - Mouse pancreas using Somatostatin (SST) antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: Somatostatin Antibody [NBP2-93171] - analysis of Rat brain, using Somatostatin (SST) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] - Immunofluorescence analysis of paraffin-embedded mouse pancreas using Somatostatin Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] - Immunofluorescence analysis of paraffin-embedded rat pancreas using Somatostatin Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Somatostatin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Somatostatin Antibody - BSA Free (NBP2-93171) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Somatostatin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human SST (NP_001039.1). TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SST
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Somatostatin Antibody - BSA Free

• Growth hormone release-inhibiting factor
• SMST
• SOM
• Somatostatin
• somatostatin-14
• somatostatin-28
• SRIF
• SST

Background

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Somatostatin Antibody (NBP2-93171)(1)

Publication using NBP2-93171

• Shao W, Zheng H, Zhu J et al. Deletions of Cacna2d3 in parvalbumin-expressing neurons leads to autistic-like phenotypes in mice Neurochemistry international 2023-07-05 [PMID: 37419212]

Bioinformatics

• Gene Symbol: SST