Soluble Liver/Pancreas Antigen Antibody

Images

 
Western Blot: Soluble Liver/Pancreas Antigen Antibody [NBP1-57253] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: Soluble Liver/Pancreas Antigen Antibody [NBP1-57253] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Soluble Liver/Pancreas Antigen Antibody Summary

Immunogen
Synthetic peptides corresponding to SLA/LP(soluble liver antigen/liver pancreas antigen) The peptide sequence was selected from the N terminal of SLA/LP. Peptide sequence MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPSECS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLA/LP and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Soluble Liver/Pancreas Antigen Antibody

  • EC 2.9.1.2
  • EC 2.9.1.n1
  • Liver-pancreas antigen
  • LPDKFZp434B1417
  • MGC161491
  • O-phosphoseryl-tRNA(Sec) selenium transferase
  • Sec synthase
  • Selenocysteine synthase
  • Selenocysteinyl-tRNA(Sec) synthase
  • Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
  • SepSecS
  • Sep-tRNA:Sec-tRNA synthase
  • SLA/LP autoantigen
  • SLA/LP
  • SLA-p35
  • SLAUGA suppressor tRNA-associated protein
  • Soluble liver antigen
  • soluble liver antigen/liver pancreas antigen
  • tRNA(Ser/Sec)-associated antigenic protein
  • TRNP48

Background

SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu
Applications: WB, ELISA
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB200-527
Species: Hu, Mu, Rt
Applications: WB
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
AF7895
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
7954-GM/CF
Species: Hu
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57253
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P

Publications for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253) (0)

There are no publications for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253) (0)

There are no reviews for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Soluble Liver/Pancreas Antigen Products

Bioinformatics Tool for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253)

Discover related pathways, diseases and genes to Soluble Liver/Pancreas Antigen Antibody (NBP1-57253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253)

Discover more about diseases related to Soluble Liver/Pancreas Antigen Antibody (NBP1-57253).
 

Pathways for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253)

View related products by pathway.

PTMs for Soluble Liver/Pancreas Antigen Antibody (NBP1-57253)

Learn more about PTMs related to Soluble Liver/Pancreas Antigen Antibody (NBP1-57253).

Blogs on Soluble Liver/Pancreas Antigen

There are no specific blogs for Soluble Liver/Pancreas Antigen, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Soluble Liver/Pancreas Antigen Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPSECS
Uniprot