SNX27 Antibody

Images

 
Western Blot: SNX27 Antibody [NBP2-86820] - Host: Rabbit. Target Name: SNX27. Sample Tissue: Mouse Kidney lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX27 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SNX27. Peptide sequence: VDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNX27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX27 Antibody

  • KIAA0488MGC126873
  • methamphetamine-responsive transcript 1
  • MGC126871
  • MGC20471
  • MRT1
  • MY014
  • sorting nexin family member 27
  • sorting nexin-27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1002
Species: Hu
Applications: IF, PEP-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
H00009784-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3926
Species: Hu, Mu, Rt
Applications: WB
H00010491-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-78403
Species: Hu
Applications: ICC/IF, WB
NBP2-52977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SNX27 Antibody (NBP2-86820) (0)

There are no publications for SNX27 Antibody (NBP2-86820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX27 Antibody (NBP2-86820) (0)

There are no reviews for SNX27 Antibody (NBP2-86820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX27 Antibody (NBP2-86820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX27 Products

Array NBP2-86820

Bioinformatics Tool for SNX27 Antibody (NBP2-86820)

Discover related pathways, diseases and genes to SNX27 Antibody (NBP2-86820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX27 Antibody (NBP2-86820)

Discover more about diseases related to SNX27 Antibody (NBP2-86820).
 

Pathways for SNX27 Antibody (NBP2-86820)

View related products by pathway.

PTMs for SNX27 Antibody (NBP2-86820)

Learn more about PTMs related to SNX27 Antibody (NBP2-86820).
 

Research Areas for SNX27 Antibody (NBP2-86820)

Find related products by research area.

Blogs on SNX27.

Spotlight on SNX27 Antibodies
Sorting Nexin Family Member 27 (SNX27) binds the cell membrane to regulate endocytic vesicular and protein trafficking. SNX27 has also been shown to play a key role in the endocytic recycling pathway, whereby internalized membrane proteins and lipids ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX27