SNX17 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SNX17 Antibody [NBP1-92417] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX17 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SNX17 Protein (NBP1-92417PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX17 Antibody - BSA Free

• KIAA0064sorting nexin-17
• sorting nexin 17

Background

The SNX17 gene encodes a member of the sorting nexin family. Members of this family are involved in intracellular trafficking, and contain a phox (PX) domain, which is a phosphoinositide binding domain. The protein contains a B41 domain, but does not contain a coiled coil region, like some family members. This protein interacts with the cytoplasmic domain of P-selectin, and may function in the intracellular trafficking of P-selectin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNX17 Antibody (NBP1-92417)(2)

Publications using NBP1-92417

• Singh V, Lin R, Sunuwar L et al. Differential Regulation of NHE3 Expression in Type 1 and Type 2 Diabetic Intestine: Impaired Endosomal Regulation of NHE3 Expression in Type 1 Diabetes. American Journal of Physiology - Cell Physiology 2025-09-10 [PMID: 40929175]
• Nauth T, Bazgir F, Vob H et al. Cutaneous manifestations in Costello syndrome: HRAS p.Gly12Ser affects RIN1-mediated integrin trafficking in immortalized epidermal keratinocytes Human molecular genetics 2022-08-18 [PMID: 35981076] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: SNX17