SNX2 Antibody - BSA Free

Analysis in human lymph node and skeletal muscle tissues using NBP1-89485 antibody. Corresponding SNX2 RNA-seq data are presented for the same tissues.

Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Analysis in human cell line BEWO.

Western Blot: SNX2 Antibody [NBP1-89485] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNX2 Antibody - BSA Free (NBP1-89485) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SNX2 Protein (NBP1-89485PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX2 Antibody - BSA Free

• MGC5204
• sorting nexin 2
• sorting nexin-2
• Transformation-related gene 9 protein
• TRG-9

Background

SNX2 (Sorting nexin 2) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. SNX2 is a component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. It may form oligomeric complexes with family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNX2