SNX2 Antibody

Images

 
Western Blot: SNX2 Antibody [NBP1-89485] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: SNX2 Antibody [NBP1-89485] - Staining of human cell line A-431 shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: SNX2 Antibody [NBP1-89485] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in tubule cells.
Western Blot: SNX2 Antibody [NBP1-89485] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SNX2 Antibody [NBP1-89485] - Staining of human cell line U-2 OS shows positivity in vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNX2 Protein (NBP1-89485PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX2 Antibody

  • MGC5204
  • sorting nexin 2
  • sorting nexin-2
  • Transformation-related gene 9 protein
  • TRG-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP1-85288
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, SignalStim
AF3926
Species: Hu, Mu, Rt
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
MAB6747
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-90979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for SNX2 Antibody (NBP1-89485) (0)

There are no publications for SNX2 Antibody (NBP1-89485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX2 Antibody (NBP1-89485) (0)

There are no reviews for SNX2 Antibody (NBP1-89485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNX2 Antibody (NBP1-89485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX2 Products

Bioinformatics Tool for SNX2 Antibody (NBP1-89485)

Discover related pathways, diseases and genes to SNX2 Antibody (NBP1-89485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX2 Antibody (NBP1-89485)

Discover more about diseases related to SNX2 Antibody (NBP1-89485).
 

Pathways for SNX2 Antibody (NBP1-89485)

View related products by pathway.

PTMs for SNX2 Antibody (NBP1-89485)

Learn more about PTMs related to SNX2 Antibody (NBP1-89485).
 

Research Areas for SNX2 Antibody (NBP1-89485)

Find related products by research area.

Blogs on SNX2

There are no specific blogs for SNX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX2