SNX16 Antibody (1E9) - Azide and BSA Free Summary
| Immunogen |
SNX16 (AAH33630, 1 a.a. ~ 344 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED |
| Specificity |
SNX16 - sorting nexin 16 (1E9) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SNX16 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SNX16 Antibody (1E9) - Azide and BSA Free
Background
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The function of this protein has not been determined. This gene results in three transcript variants encoding two distinct isoforms. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Publications for SNX16 Antibody (H00064089-M07) (0)
There are no publications for SNX16 Antibody (H00064089-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SNX16 Antibody (H00064089-M07) (0)
There are no reviews for SNX16 Antibody (H00064089-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SNX16 Antibody (H00064089-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SNX16 Products
Research Areas for SNX16 Antibody (H00064089-M07)
Find related products by research area.
|
Blogs on SNX16