SNRPD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SNRPD2 Antibody [NBP1-87028] - Staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: SNRPD2 Antibody [NBP1-87028] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

• Reactivity: Hu, Mu, Rt, Dr
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNRPD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNRPD2 Antibody - BSA Free (NBP1-87028) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SNRPD2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  SNRPD2 Recombinant Protein Antigen (NBP1-87028PEP)

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 31597093).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNRPD2 Antibody - BSA Free

• small nuclear ribonucleoprotein D2 polypeptide (16.5kD)
• small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
• small nuclear ribonucleoprotein Sm D2
• Sm-D2SMD2
• snRNP core protein D2
• SNRPD1

Background

The protein encoded by the SNRPD2 gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNRPD2 Antibody (NBP1-87028)(1)

Publication using NBP1-87028

• Hsieh Y, Guo C, Yalamanchili H et al. Tau-mediated Disruption of the Spliceosome Triggers Cryptic RNA-splicing and Neurodegeneration in Alzheimer's Disease Cell Rep 2019-10-10 [PMID: 31597093] (WB, Drosophila)

Bioinformatics

• Gene Symbol: SNRPD2