SNRPB Antibody - BSA Free

Western Blot: SNRPB Antibody [NBP3-35914] - Western blot analysis of various lysates using SNRPB Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNRPB Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPB (NP_003082.1).
  
  Sequence:
  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SNRPB Antibody - BSA Free

• CODB polypeptide of Sm protein
• Sm protein B/B'
• small nuclear ribonucleoprotein polypeptides B and B'
• small nuclear ribonucleoprotein polypeptides B and B1
• small nuclear ribonucleoprotein-associated proteins B and B'
• SmB/B'
• Sm-B/B'sm-B/Sm-B'
• SmB/SmB'
• snRNP-Bsmall nuclear ribonucleoprotein polypeptide B
• SNRPB1

Background

SNRPB is encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPB