SNRPA1 Antibody

Images

 
Western Blot: SNRPA1 Antibody [NBP1-57240] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Sh, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRPA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SNRPA1(small nuclear ribonucleoprotein polypeptide A') The peptide sequence was selected from the N terminal of SNRPA1 (NP_003081). Peptide sequence VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SNRPA1 Antibody

  • Lea1
  • small nuclear ribonucleoprotein polypeptide A'
  • U2 small nuclear ribonucleoprotein A'
  • U2 small nuclear ribonucleoprotein polypeptide A'
  • U2 snRNP A'

Background

SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66163
Species: Hu
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57138
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ye
Applications: WB
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
AF3025
Species: Hu
Applications: WB, ELISA, ICC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-83324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81280
Species: Hu
Applications: IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ye, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-62654
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SNRPA1 Antibody (NBP1-57240) (0)

There are no publications for SNRPA1 Antibody (NBP1-57240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPA1 Antibody (NBP1-57240) (0)

There are no reviews for SNRPA1 Antibody (NBP1-57240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRPA1 Antibody (NBP1-57240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNRPA1 Products

Bioinformatics Tool for SNRPA1 Antibody (NBP1-57240)

Discover related pathways, diseases and genes to SNRPA1 Antibody (NBP1-57240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPA1 Antibody (NBP1-57240)

Discover more about diseases related to SNRPA1 Antibody (NBP1-57240).

Research Areas for SNRPA1 Antibody (NBP1-57240)

Find related products by research area.

Blogs on SNRPA1

There are no specific blogs for SNRPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPA1
Entrez
Uniprot