LIN9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LIN9 Antibody [NBP1-80690] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LIN9 Antibody [NBP1-80690] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: LIN9 Antibody [NBP1-80690] - Staining of human testis shows moderate nuclear positivity in Leydig cells and cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LIN9 Antibody [NBP1-80690] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LIN9 Antibody [NBP1-80690] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Immunohistochemistry-Paraffin: LIN9 Antibody [NBP1-80690] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LIN9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIN9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LIN9 Protein (NBP1-80690PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LIN9 Antibody - BSA Free

• BARA
• BARPsv
• hLin-9
• huLin-9
• lin-9 homolog (C. elegans)
• Lin-9
• pRB-associated protein
• protein lin-9 homolog
• rb related pathway actor
• TGS1
• TGSBeta subunit-associated regulator of apoptosis
• TUDOR gene similar protein
• Type I interferon receptor beta chain-associated protein

Background

LIN9 acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation ismediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LIN9 Antibody (NBP1-80690)(2)

Publications using NBP1-80690

• Klucnika A, Mu P, Jezek J et al. REC drives recombination to repair double-strand breaks in animal mtDNA The Journal of cell biology 2023-01-02 [PMID: 36355348] (WB, Human)
• Zhu J, Yang Q, Li H et al. Sirt3 deficiency accelerates ovarian senescence without affecting spermatogenesis in aging mice Free radical biology & medicine 2022-11-03 [PMID: 36336229]

Bioinformatics

• Gene Symbol: LIN9
• Entrez:
  • 286826(Human)