SNRK Antibody

Images

 
Western Blot: SNRK Antibody [NBP1-83668] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SNRK Antibody [NBP1-83668] - Staining of human cell line U-2 OS shows localization to cell junctions & vesicles.
Immunohistochemistry-Paraffin: SNRK Antibody [NBP1-83668] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: SNRK Antibody [NBP1-83668] - Analysis in human cell line PC-3.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELAGPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIFEEGESDDEFDMDENLPPKLSRLKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNRK Protein (NBP1-83668PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNRK Antibody

  • DKFZp779A1866
  • EC 2.7.11
  • EC 2.7.11.1
  • HSNFRK
  • KIAA0096FLJ20224
  • SNF related kinase
  • SNF-1 related kinase
  • SNF1-related kinase
  • SNF-related serine/threonine-protein kinase
  • SNFRK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81880
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-82547
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00083942-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
MAB6978
Species: Hu, Mu, Rt
Applications: WB
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-83668
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SNRK Antibody (NBP1-83668) (0)

There are no publications for SNRK Antibody (NBP1-83668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRK Antibody (NBP1-83668) (0)

There are no reviews for SNRK Antibody (NBP1-83668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNRK Antibody (NBP1-83668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRK Products

Bioinformatics Tool for SNRK Antibody (NBP1-83668)

Discover related pathways, diseases and genes to SNRK Antibody (NBP1-83668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRK Antibody (NBP1-83668)

Discover more about diseases related to SNRK Antibody (NBP1-83668).
 

Pathways for SNRK Antibody (NBP1-83668)

View related products by pathway.

PTMs for SNRK Antibody (NBP1-83668)

Learn more about PTMs related to SNRK Antibody (NBP1-83668).
 

Research Areas for SNRK Antibody (NBP1-83668)

Find related products by research area.

Blogs on SNRK

There are no specific blogs for SNRK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRK