NUAK2 Antibody

Images

 
Western Blot: NUAK2 Antibody [NBP1-81880] - Analysis in control (vector only transfected HEK293T lysate) and NUAK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: NUAK2 Antibody [NBP1-81880] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUAK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Specificity
Specificity of human NUAK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUAK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUAK2 Protein (NBP1-81880PEP)
Publications
Read Publications using NBP1-81880.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUAK2 Antibody

  • DKFZp434J037
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ90349
  • NUAK family SNF1-like kinase 2
  • NUAK family, SNF1-like kinase, 2
  • SNARKDKFZp686F01113
  • SNF1/AMP activated protein kinase
  • SNF1/AMP kinase-related kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB6978
Species: Hu, Mu, Rt
Applications: WB
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4820
Species: Hu
Applications: WB, IHC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-33533
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
126-FL/CF
Species: Hu
NBP1-83668
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-81880
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUAK2 Antibody (NBP1-81880)(2)

Reviews for NUAK2 Antibody (NBP1-81880) (0)

There are no reviews for NUAK2 Antibody (NBP1-81880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUAK2 Antibody (NBP1-81880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NUAK2 Antibody (NBP1-81880)

Discover related pathways, diseases and genes to NUAK2 Antibody (NBP1-81880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUAK2 Antibody (NBP1-81880)

Discover more about diseases related to NUAK2 Antibody (NBP1-81880).
 

Pathways for NUAK2 Antibody (NBP1-81880)

View related products by pathway.

PTMs for NUAK2 Antibody (NBP1-81880)

Learn more about PTMs related to NUAK2 Antibody (NBP1-81880).

Blogs on NUAK2

There are no specific blogs for NUAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUAK2
Entrez
Uniprot