TSSK1 Antibody (4F12)

Images

 
Western Blot: TSSK1 Antibody (4F12) [H00083942-M01] - Analysis of TSSK1 expression in transfected 293T cell line by TSSK1 monoclonal antibody (M01), clone 4F12.Lane 1: TSSK1 transfected lysate(41.6 KDa).Lane 2: ...read more
ELISA: TSSK1 Antibody (4F12) [H00083942-M01] - Detection limit for recombinant GST tagged TSSK1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
4F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSSK1 Antibody (4F12) Summary

Immunogen
TSSK1B (AAH22515, 267 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ
Specificity
TSSK1 - testis-specific serine kinase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSK1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. Immunocytochemistry/Immunofluorescence and Immunohistochemistry were reported in scientific literature.
Reviewed Applications
Read 1 Review rated 5
using
H00083942-M01 in the following applications:

Publications
Read Publication using
H00083942-M01 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in customer review.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSK1 Antibody (4F12)

  • EC 2.7.11
  • serine/threonine kinase 22D (spermiogenesis associated)
  • Serine/threonine-protein kinase 22A
  • spermiogenesis associated 4
  • SPOGA1
  • SPOGA4EC 2.7.11.1
  • STK22A
  • STK22DFKSG81
  • Testis-specific kinase 1
  • testis-specific serine kinase 1
  • testis-specific serine kinase 1B
  • testis-specific serine/threonine-protein kinase 1
  • TSK-1
  • TSSK-1
  • TSSK1serine/threonine kinase FKSG81

Background

TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023617-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00083983-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-54878
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-56284
Species: Hu
Applications: ICC/IF, WB
H00081629-D01P
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
6507-IL/CF
Species: Hu
Applications: BA
QET00B
Species: Hu
Applications: ELISA
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for TSSK1 Antibody (H00083942-M01)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for TSSK1 Antibody (H00083942-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00083942-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
John Pawlak
WB Mouse 07/11/2012
View

Summary

ApplicationWestern Blot
Sample TestedMouse Sperm
SpeciesMouse
Lot7163-4f12-00Aa*6

Blocking

Blocking Details5% Milk in T-TBS for 1 hour room temp

Primary Anitbody

Dilution Ratio1:1000 dilution in T-TBS at 4 degrees C, overnight rocking

Secondary Antibody

Secondary Descriptionanti-Mouse HRP
Secondary Concentration1:10,000 dilution

Details

Detection NotesECL regular exposed to film for about 30 seconds

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSK1 Antibody (H00083942-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSSK1 Products

Bioinformatics Tool for TSSK1 Antibody (H00083942-M01)

Discover related pathways, diseases and genes to TSSK1 Antibody (H00083942-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSK1 Antibody (H00083942-M01)

Discover more about diseases related to TSSK1 Antibody (H00083942-M01).

Research Areas for TSSK1 Antibody (H00083942-M01)

Find related products by research area.

Blogs on TSSK1

There are no specific blogs for TSSK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
John Pawlak
07/11/2012
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol TSSK1B
Entrez
Uniprot