SNN Antibody

Immunohistochemistry-Paraffin: SNN Antibody [NBP1-91104] - Analysis in human cerebral cortex and pancreas tissues using NBP1-91104 antibody. Corresponding SNN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SNN Antibody [NBP1-91104] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SNN Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SNN Protein (NBP1-91104PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SNN Antibody

• AG8_1
• stannin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNN