Dematin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Dematin Antibody [NBP1-85007] - Staining of human cell line U-251MG shows positivity in nucleus and cytoplasm.
Immunohistochemistry-Paraffin: Dematin Antibody [NBP1-85007] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dematin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPB49
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dematin Protein (NBP1-85007PEP)
Publications
Read Publication using NBP1-85007.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dematin Antibody

  • dematin
  • DMTFLJ78462
  • erythrocyte membrane protein band 4.9 (dematin)
  • Erythrocyte membrane protein band 4.9
  • FLJ98848

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Dematin Antibody (NBP1-85007)(1)

Reviews for Dematin Antibody (NBP1-85007) (0)

There are no reviews for Dematin Antibody (NBP1-85007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Dematin Antibody (NBP1-85007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dematin Products

Bioinformatics Tool for Dematin Antibody (NBP1-85007)

Discover related pathways, diseases and genes to Dematin Antibody (NBP1-85007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dematin Antibody (NBP1-85007)

Discover more about diseases related to Dematin Antibody (NBP1-85007).
 

Pathways for Dematin Antibody (NBP1-85007)

View related products by pathway.

PTMs for Dematin Antibody (NBP1-85007)

Learn more about PTMs related to Dematin Antibody (NBP1-85007).

Blogs on Dematin

There are no specific blogs for Dematin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dematin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB49