KIF20A Antibody

Images

 
Western Blot: KIF20A Antibody [NBP1-87176] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: KIF20A Antibody [NBP1-87176] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF20A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF20A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
KIF20A Protein (NBP1-87176PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF20A Antibody

  • FLJ21151
  • GG10_2
  • kinesin family member 20A
  • kinesin-like protein KIF20A
  • mitotic kinesin-like protein 2
  • MKLP2
  • Rab6-interacting kinesin-like protein
  • RAB6KIFLkinesin-like (rabkinesin6)
  • rabkinesin-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83252
Species: Hu
Applications: WB, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-55075
Species: Hu
Applications: ICC/IF
AF4185
Species: Hu
Applications: ICC
NBP1-89033
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88050
Species: Hu
Applications: IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIF20A Antibody (NBP1-87176) (0)

There are no publications for KIF20A Antibody (NBP1-87176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF20A Antibody (NBP1-87176) (0)

There are no reviews for KIF20A Antibody (NBP1-87176). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIF20A Antibody (NBP1-87176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF20A Products

Bioinformatics Tool for KIF20A Antibody (NBP1-87176)

Discover related pathways, diseases and genes to KIF20A Antibody (NBP1-87176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF20A Antibody (NBP1-87176)

Discover more about diseases related to KIF20A Antibody (NBP1-87176).
 

Pathways for KIF20A Antibody (NBP1-87176)

View related products by pathway.

Research Areas for KIF20A Antibody (NBP1-87176)

Find related products by research area.

Blogs on KIF20A

There are no specific blogs for KIF20A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF20A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF20A
Entrez
Uniprot