SNF5 Antibody

Images

 
Genetic Strategies: Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human liver shows very weak positivity in hepatocytes as expected.
Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Western Blot: SNF5 Antibody [NBP1-90013] - Analysis using Anti-SMARCB1 antibody NBP1-90013 (A) shows similar pattern to independent antibody NBP1-90014 (B).
Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human tonsil shows nuclear positivity.
Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and in cells in granular and molecular layer.
Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMARCB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNF5 Recombinant Protein Antigen (NBP1-90013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNF5 Antibody

  • BAF47
  • BAF47hSNF5
  • BRG1-associated factor 47
  • hSNFS
  • Ini1
  • INI1RTPS1
  • Integrase interactor 1 protein
  • malignant rhabdoid tumor suppressor
  • RDTSNF5 homolog
  • Sfh1p
  • SNF5
  • SNF5L1
  • Snr1
  • subfamily b, member 1
  • sucrose nonfermenting, yeast, homolog-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20415
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP2-52559
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
H00000072-D01P
Species: Hu
Applications: WB
NBP1-90013
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for SNF5 Antibody (NBP1-90013) (0)

There are no publications for SNF5 Antibody (NBP1-90013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNF5 Antibody (NBP1-90013) (0)

There are no reviews for SNF5 Antibody (NBP1-90013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNF5 Antibody (NBP1-90013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNF5 Products

Bioinformatics Tool for SNF5 Antibody (NBP1-90013)

Discover related pathways, diseases and genes to SNF5 Antibody (NBP1-90013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF5 Antibody (NBP1-90013)

Discover more about diseases related to SNF5 Antibody (NBP1-90013).
 

Pathways for SNF5 Antibody (NBP1-90013)

View related products by pathway.

PTMs for SNF5 Antibody (NBP1-90013)

Learn more about PTMs related to SNF5 Antibody (NBP1-90013).
 

Research Areas for SNF5 Antibody (NBP1-90013)

Find related products by research area.

Blogs on SNF5.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCB1