SNF5 Antibody - BSA Free

Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human liver shows very weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and in cells in granular and molecular layer.

Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Staining of human lymph node shows strong nuclear positivity in germinal and non germinal center cells.

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMARCB1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: SNF5 Antibody [NBP1-90013] - Analysis using Anti-SMARCB1 antibody NBP1-90013 (A) shows similar pattern to independent antibody NBP1-90014 (B).

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

ChIP-Exo-Seq composite graph for Anti-SMARCB1 (NBP1-90013) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ChIP, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNF5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNF5 Antibody - BSA Free (NBP1-90013) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SNF5 Recombinant Protein Antigen (NBP1-90013PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNF5 Antibody - BSA Free

• BAF47
• BAF47hSNF5
• BRG1-associated factor 47
• hSNFS
• Ini1
• INI1RTPS1
• Integrase interactor 1 protein
• malignant rhabdoid tumor suppressor
• RDTSNF5 homolog
• Sfh1p
• SNF5
• SNF5L1
• Snr1
• subfamily b, member 1
• sucrose nonfermenting, yeast, homolog-like 1
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

SNF5 is encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCB1