SMYD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMYD2 Antibody [NBP1-83186] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: SMYD2 Antibody [NBP1-83186] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMYD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMYD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMYD2 Protein (NBP1-83186PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMYD2 Antibody

  • EC 2.1.1.43
  • Histone methyltransferase SMYD2
  • HSKM-Bzinc finger, MYND domain containing 14
  • KMT3CEC 2.1.1.-
  • Lysine N-methyltransferase 3C
  • MGC119305
  • SET and MYND domain containing 2
  • SET and MYND domain-containing protein 2
  • ZMYND14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56664
Species: Hu, Mu
Applications: WB, ChIP, IHC-P
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20430
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IP
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-342
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-83186
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SMYD2 Antibody (NBP1-83186) (0)

There are no publications for SMYD2 Antibody (NBP1-83186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMYD2 Antibody (NBP1-83186) (0)

There are no reviews for SMYD2 Antibody (NBP1-83186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMYD2 Antibody (NBP1-83186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMYD2 Products

Bioinformatics Tool for SMYD2 Antibody (NBP1-83186)

Discover related pathways, diseases and genes to SMYD2 Antibody (NBP1-83186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMYD2 Antibody (NBP1-83186)

Discover more about diseases related to SMYD2 Antibody (NBP1-83186).
 

Pathways for SMYD2 Antibody (NBP1-83186)

View related products by pathway.

PTMs for SMYD2 Antibody (NBP1-83186)

Learn more about PTMs related to SMYD2 Antibody (NBP1-83186).

Blogs on SMYD2

There are no specific blogs for SMYD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMYD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMYD2