Smoothened Antibody (2F8)

Images

 
ELISA: Smoothened Antibody (2F8) [H00006608-M07] - Detection limit for recombinant GST tagged SMO is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smoothened Antibody (2F8) Summary

Immunogen
SMO (NP_005622, 56 a.a. - 155 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Specificity
SMO (2F8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMO
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smoothened Antibody (2F8)

  • Gx
  • Protein Gx
  • SMOHseven transmembrane helix receptor
  • smoothened (Drosophila) homolog
  • smoothened homolog (Drosophila)
  • smoothened homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF482
Species: Mu
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF196
Species: Mu
Applications: WB, IHC
H00006608-M07
Species: Hu
Applications: ELISA

Publications for Smoothened Antibody (H00006608-M07) (0)

There are no publications for Smoothened Antibody (H00006608-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smoothened Antibody (H00006608-M07) (0)

There are no reviews for Smoothened Antibody (H00006608-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Smoothened Antibody (H00006608-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smoothened Products

Bioinformatics Tool for Smoothened Antibody (H00006608-M07)

Discover related pathways, diseases and genes to Smoothened Antibody (H00006608-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smoothened Antibody (H00006608-M07)

Discover more about diseases related to Smoothened Antibody (H00006608-M07).
 

Pathways for Smoothened Antibody (H00006608-M07)

View related products by pathway.

PTMs for Smoothened Antibody (H00006608-M07)

Learn more about PTMs related to Smoothened Antibody (H00006608-M07).
 

Research Areas for Smoothened Antibody (H00006608-M07)

Find related products by research area.

Blogs on Smoothened.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Pancreatic Cancer Research Targets Hedgehog Signaling Pathway
The Hedgehog Signaling Pathway (HSP) is an important pathway involved in embryonic development by regulating cell differentiation. This pathway has also become an increasingly hot topic in cancer research in recent years. The HSP involves the interact...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smoothened Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMO
Entrez
OMIM
Uniprot