SMCHD1 Antibody (CL4270)


Immunohistochemistry-Paraffin: SMCHD1 Antibody [NBP2-59046] - Staining of human skeletal muscle shows no positivity as expected (negative control).
Immunohistochemistry-Paraffin: SMCHD1 Antibody [NBP2-59046] - Staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells.
Immunohistochemistry: SMCHD1 Antibody [NBP2-59046] - Staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells.
Immunohistochemistry: SMCHD1 Antibody [NBP2-59046] - Staining of human placenta shows strong nuclear immunoreactivity in trophoblast.
Immunohistochemistry: SMCHD1 Antibody [NBP2-59046] - Staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SMCHD1 Antibody (CL4270) Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Specificity of human SMCHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for SMCHD1 Antibody (CL4270)

  • DKFZp686O0631
  • KIAA0650
  • structural maintenance of chromosomes flexible hinge domain containing 1
  • structural maintenance of chromosomes flexible hinge domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMCHD1 Antibody (NBP2-59046) (0)

There are no publications for SMCHD1 Antibody (NBP2-59046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMCHD1 Antibody (NBP2-59046) (0)

There are no reviews for SMCHD1 Antibody (NBP2-59046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMCHD1 Antibody (NBP2-59046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SMCHD1 Antibody (NBP2-59046)

Discover related pathways, diseases and genes to SMCHD1 Antibody (NBP2-59046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCHD1 Antibody (NBP2-59046)

Discover more about diseases related to SMCHD1 Antibody (NBP2-59046).

Pathways for SMCHD1 Antibody (NBP2-59046)

View related products by pathway.

PTMs for SMCHD1 Antibody (NBP2-59046)

Learn more about PTMs related to SMCHD1 Antibody (NBP2-59046).

Research Areas for SMCHD1 Antibody (NBP2-59046)

Find related products by research area.

Blogs on SMCHD1

There are no specific blogs for SMCHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SMCHD1 Antibody (CL4270) and receive a gift card or discount.


Gene Symbol SMCHD1