SMARCD3 Antibody - BSA Free

Western Blot: SMARCD3 Antibody [NBP1-79718] - Titration: 1.0 ug/ml Positive Control: Mouse Brain.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SMARCD3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Smarcd3. Peptide sequence DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SMARCD3 Antibody - BSA Free

• 60 kDa BRG-1/Brm-associated factor subunit C
• 60kDa BRG-1/Brm associated factor subunit c
• BAF60Cchromatin remodeling complex BAF60C subunit
• BRG1-associated factor 60C
• CRACD3
• mammalian chromatin remodeling complex BRG1-associated factor 60C
• MGC111010
• Rsc6p
• subfamily d, member 3
• SWI/SNF complex 60 kDa subunit C
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3
• Swp73-like protein

Background

SMARCD3 is encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCD3
• Uniprot:
  • NP_080167(Mouse)